PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009934m
Common NameCARUB_v10009934mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 286aa    MW: 32084.6 Da    PI: 8.1407
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009934mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.3e-34135192259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
  Carubv10009934m 135 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPSIVITTYEGKHNHP 192
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-35119194IPR003657WRKY domain
SuperFamilySSF1182903.66E-30127194IPR003657WRKY domain
PROSITE profilePS5081133.063129194IPR003657WRKY domain
SMARTSM007743.9E-40134193IPR003657WRKY domain
PfamPF031069.7E-27135192IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MDDHVESKNT YLEEASFTSI TDCLQSSLVM DYNSLEKGFK FPPYGSPFQP VSPSNIGHIV  60
NNNPYLNLSS NSPMVSSPSN EADPKENPNE DNEGDQHGVR ESSKQVTKQG KKKGEKKERE  120
AKVAFLTKSE IDHLEDGYRW RKYGQKAVKN SPYPRSYYRC TTQKCNVKKR VERSFQDPSI  180
VITTYEGKHN HPIPSTLRGT VAAEHLLGHR GGGSSFLHSF PLHHRQEFLM MKHPPANYLS  240
SVGSMSNDHG HGMISSYNNN NHQPTGVDYG LLQDIVPSMF SKHES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-301271951078Probable WRKY transcription factor 4
2lex_A4e-301271951078Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAPTransfer from AT1G29860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4211580.0AF421158.1 Arabidopsis thaliana WRKY transcription factor 71 (WRKY71) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304076.10.0hypothetical protein CARUB_v10009934mg
SwissprotQ93WV41e-144WRK71_ARATH; Probable WRKY transcription factor 71
TrEMBLR0I3Y30.0R0I3Y3_9BRAS; Uncharacterized protein
STRINGAT1G29860.11e-142(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139111825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-130WRKY DNA-binding protein 71